PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.L01206.1.p
Common NameLOC105967475, MIMGU_mgv1a011170mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family WRKY
Protein Properties Length: 291aa    MW: 31284.4 Da    PI: 6.2791
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.L01206.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.99e-33160217259
                       --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       +Dgy+WrKYGqK vk+s+fprsYYrCt ++C+vkk++ers++dp+vv++tYeg+H h+
  Migut.L01206.1.p 160 EDGYRWRKYGQKAVKNSPFPRSYYRCTNSKCTVKKRIERSSDDPSVVITTYEGQHCHH 217
                       8******************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.7E-33145217IPR003657WRKY domain
SuperFamilySSF1182902.75E-28151217IPR003657WRKY domain
PROSITE profilePS5081130.446154219IPR003657WRKY domain
SMARTSM007743.9E-38159218IPR003657WRKY domain
PfamPF031061.0E-25160217IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MAGPEKADPE LNAESTWELG CPDAASHDYF FASDYRESTI LSEFGWNIPV ADSSGVCGCD  60
GGFVIGSDLI EHDLADSSAH RSSTVADASI LASPSNQSLS SSSSHEDPPE KSITTSVSSA  120
AAANSPSDTA TKSSKTTTGQ KRIQQPRFAF VTKSEVDLLE DGYRWRKYGQ KAVKNSPFPR  180
SYYRCTNSKC TVKKRIERSS DDPSVVITTY EGQHCHHSTG SYRTTLQDNI PFSRFLLSPS  240
NNPQVLHDSM PIAQSPPSVQ GHHHTAAGQE PPPPLGLLGD IVRPPGMRNG *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-271522161074Probable WRKY transcription factor 4
2lex_A3e-271522161074Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00067PBMTransfer from AT1G69310Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012847526.10.0PREDICTED: probable WRKY transcription factor 57 isoform X1
SwissprotQ9C9834e-55WRK57_ARATH; Probable WRKY transcription factor 57
TrEMBLA0A022QQS30.0A0A022QQS3_ERYGU; Uncharacterized protein
STRINGSolyc05g012500.2.16e-69(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA80312228
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69310.22e-49WRKY DNA-binding protein 57